PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00194.1.g00260.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 95aa    MW: 10477.1 Da    PI: 10.1516
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00194.1.g00260.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.51.5e-324393151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++
  Zpz_sc00194.1.g00260.1.sm.mk 43 KRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 93
                                  79***********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-413594IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.4733595IPR002100Transcription factor, MADS-box
CDDcd002652.54E-413693No hitNo description
SuperFamilySSF554553.92E-303694IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003791IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-343757IPR002100Transcription factor, MADS-box
PfamPF003191.0E-274491IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-345772IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-347293IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MLNMMSDLSC GPSAKGKEQP APANSGPSAG MSEKLGRGKI EIKRIENSTN RQVTFCKRRN  60
GLLKKAYELS VLCDAEVALI VFSSRGRLYE YANHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-223593159Myocyte-specific enhancer factor 2B
1tqe_Q5e-223593159Myocyte-specific enhancer factor 2B
1tqe_R5e-223593159Myocyte-specific enhancer factor 2B
1tqe_S5e-223593159Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306374e-61AJ430637.1 Zea mays partial mRNA for putative MADS-domain transcription factor (m23 gene).
GenBankEU9608104e-61EU960810.1 Zea mays clone 228787 MADS-box transcription factor 3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008654207.15e-47PREDICTED: AGAMOUS-like protein isoform X2
RefseqXP_008654205.15e-47PREDICTED: AGAMOUS-like protein isoform X1
SwissprotP293812e-37AGL1_ARATH; Agamous-like MADS-box protein AGL1
TrEMBLA0A0A8XZ732e-52A0A0A8XZ73_ARUDO; Uncharacterized protein
TrEMBLA0A0A9TLG62e-52A0A0A9TLG6_ARUDO; Uncharacterized protein
STRINGGRMZM2G074691_P011e-46(Zea mays)
STRINGGRMZM2G359952_P012e-46(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.22e-39MIKC_MADS family protein